Skip to content
  • Categories
  • Recent
  • Tags
  • Popular
  • World
  • Users
  • Groups
Skins
  • Light
  • Brite
  • Cerulean
  • Cosmo
  • Flatly
  • Journal
  • Litera
  • Lumen
  • Lux
  • Materia
  • Minty
  • Morph
  • Pulse
  • Sandstone
  • Simplex
  • Sketchy
  • Spacelab
  • United
  • Yeti
  • Zephyr
  • Dark
  • Cyborg
  • Darkly
  • Quartz
  • Slate
  • Solar
  • Superhero
  • Vapor

  • Default (Cyborg)
  • No Skin
Collapse
Brand Logo

CIRCLE WITH A DOT

  1. Home
  2. Uncategorized
  3. Not sure if anyone is interested, or how I should frame this.

Not sure if anyone is interested, or how I should frame this.

Scheduled Pinned Locked Moved Uncategorized
vivaldiscamsitehackertechhelpinfosec
2 Posts 2 Posters 4 Views
  • Oldest to Newest
  • Newest to Oldest
  • Most Votes
Reply
  • Reply as topic
Log in to reply
This topic has been deleted. Only users with topic management privileges can see it.
  • puck@sfba.socialP This user is from outside of this forum
    puck@sfba.socialP This user is from outside of this forum
    puck@sfba.social
    wrote last edited by
    #1

    Not sure if anyone is interested, or how I should frame this. A local business let their web site go, and it looks like someone bought the domain name and is using it to scam people. I got a tab that looks like an official microsoft page with a warning, beeping, and a voice saying to call the microsoft number shown (no way) and not to shut off the computer. I shut off computer, waited a few and turned it back on. It didn't even boot, just brought up same page. I brought up task manager, shut down #Vivaldi and it went away. Ran full scan. It was just a scam page, but it appeared that my mouse didn't work, but it worked in TM. Anyone want to look into shutting this down? I just used up what little tech ability I have just to get this far. Site is alumfloinc dot com. Hmmm, tags?

    #ScamSite #hacker #TechHelp #infosec

    justinderrick@mstdn.caJ 1 Reply Last reply
    0
    • puck@sfba.socialP puck@sfba.social

      Not sure if anyone is interested, or how I should frame this. A local business let their web site go, and it looks like someone bought the domain name and is using it to scam people. I got a tab that looks like an official microsoft page with a warning, beeping, and a voice saying to call the microsoft number shown (no way) and not to shut off the computer. I shut off computer, waited a few and turned it back on. It didn't even boot, just brought up same page. I brought up task manager, shut down #Vivaldi and it went away. Ran full scan. It was just a scam page, but it appeared that my mouse didn't work, but it worked in TM. Anyone want to look into shutting this down? I just used up what little tech ability I have just to get this far. Site is alumfloinc dot com. Hmmm, tags?

      #ScamSite #hacker #TechHelp #infosec

      justinderrick@mstdn.caJ This user is from outside of this forum
      justinderrick@mstdn.caJ This user is from outside of this forum
      justinderrick@mstdn.ca
      wrote last edited by
      #2

      @Puck DM me the domain name. I’m pretty good at getting scam/spam sites yanked.

      1 Reply Last reply
      1
      0
      • R relay@relay.mycrowd.ca shared this topic
      Reply
      • Reply as topic
      Log in to reply
      • Oldest to Newest
      • Newest to Oldest
      • Most Votes


      • Login

      • Login or register to search.
      • First post
        Last post
      0
      • Categories
      • Recent
      • Tags
      • Popular
      • World
      • Users
      • Groups